SCOPe 2.08: Domain d2co3b_: 2co3 B:

Lineage for d2co3b_ (2co3 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [187563] (2 PDB entries)

8. Domain d2co3b_: 2co3 B: [130666]
   Other proteins in same PDB: d2co3a1
   automated match to d2co3a1
   mutant

Details for d2co3b_

PDB Entry: 2co3, 1.78 Å

PDB Description: salmonella enterica safa pilin, head-to-tail swapped dimer of ntd1 mutant

PDB Compounds: (B:) safa pilus subunit

SCOPe Domain Sequences for d2co3b_:

Sequence; same for both SEQRES and ATOM records:

>d2co3b_ b.2.3.2 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
gsqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvv
dstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqn
vtadtypitldvvgyq

Timeline for d2co3b_:

• d2co3b_ first appeared in SCOP 1.73, called d2co3b1
  
• d2co3b_ appears in SCOPe 2.07