![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
![]() | Protein automated matches [190569] (9 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:99287] [187563] (2 PDB entries) |
![]() | Domain d2co3b_: 2co3 B: [130666] Other proteins in same PDB: d2co3a1 automated match to d2co3a1 mutant |
PDB Entry: 2co3 (more details), 1.78 Å
SCOPe Domain Sequences for d2co3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co3b_ b.2.3.2 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]} gsqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvv dstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqn vtadtypitldvvgyq
Timeline for d2co3b_: