Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
Protein automated matches [190569] (10 species) not a true protein |
Species Salmonella enterica [TaxId:28901] [187562] (1 PDB entry) |
Domain d2co2a_: 2co2 A: [130664] automated match to d2co7a1 mutant |
PDB Entry: 2co2 (more details), 2.3 Å
SCOPe Domain Sequences for d2co2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co2a_ b.2.3.2 (A:) automated matches {Salmonella enterica [TaxId: 28901]} ltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagkntg keigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvgy q
Timeline for d2co2a_: