![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (6 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (8 proteins) |
![]() | Protein SafA pilus subunit [141080] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [141081] (10 PDB entries) Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170 |
![]() | Domain d2co2a1: 2co2 A:23-143 [130664] automatically matched to 2CO7 A:20-144 mutant |
PDB Entry: 2co2 (more details), 2.3 Å
SCOP Domain Sequences for d2co2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co2a1 b.2.3.2 (A:23-143) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]} ltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagkntg keigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvgy q
Timeline for d2co2a1: