Lineage for d2co2a1 (2co2 A:23-143)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659391Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 659396Family b.2.3.2: Pilus subunits [49405] (5 proteins)
  6. 659465Protein SafA pilus subunit [141080] (1 species)
  7. 659466Species Salmonella typhimurium [TaxId:90371] [141081] (8 PDB entries)
  8. 659475Domain d2co2a1: 2co2 A:23-143 [130664]
    automatically matched to 2CO7 A:20-144
    mutant

Details for d2co2a1

PDB Entry: 2co2 (more details), 2.3 Å

PDB Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f3a mutant)
PDB Compounds: (A:) safa pilus subunit

SCOP Domain Sequences for d2co2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co2a1 b.2.3.2 (A:23-143) SafA pilus subunit {Salmonella typhimurium [TaxId: 602]}
ltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagkntg
keigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvgy
q

SCOP Domain Coordinates for d2co2a1:

Click to download the PDB-style file with coordinates for d2co2a1.
(The format of our PDB-style files is described here.)

Timeline for d2co2a1: