Lineage for d2co1a_ (2co1 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300809Protein automated matches [190569] (7 species)
    not a true protein
  7. 1300828Species Salmonella typhimurium [TaxId:90371] [187560] (4 PDB entries)
  8. 1300832Domain d2co1a_: 2co1 A: [130663]
    automated match to d2co7a1
    mutant

Details for d2co1a_

PDB Entry: 2co1 (more details), 2.4 Å

PDB Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f17a mutant)
PDB Compounds: (A:) putative outer membrane protein

SCOPe Domain Sequences for d2co1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co1a_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
yqp

SCOPe Domain Coordinates for d2co1a_:

Click to download the PDB-style file with coordinates for d2co1a_.
(The format of our PDB-style files is described here.)

Timeline for d2co1a_: