Lineage for d2cnza_ (2cnz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771869Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1771874Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1772012Protein automated matches [190569] (8 species)
    not a true protein
  7. 1772036Species Salmonella typhimurium [TaxId:90371] [187560] (4 PDB entries)
  8. 1772037Domain d2cnza_: 2cnz A: [130662]
    automated match to d2co7a1
    mutant

Details for d2cnza_

PDB Entry: 2cnz (more details), 1.8 Å

PDB Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (v13a mutant)
PDB Compounds: (A:) putative outer membrane protein

SCOPe Domain Sequences for d2cnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnza_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
yqp

SCOPe Domain Coordinates for d2cnza_:

Click to download the PDB-style file with coordinates for d2cnza_.
(The format of our PDB-style files is described here.)

Timeline for d2cnza_: