SCOPe 2.01: Domain d2cnza_: 2cnz A:

Lineage for d2cnza_ (2cnz A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein automated matches [190569] (5 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [187560] (4 PDB entries)

8. Domain d2cnza_: 2cnz A: [130662]
   automated match to d2co7a1
   mutant

Details for d2cnza_

PDB Entry: 2cnz, 1.8 Å

PDB Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (v13a mutant)

PDB Compounds: (A:) putative outer membrane protein

SCOPe Domain Sequences for d2cnza_:

Sequence; same for both SEQRES and ATOM records:

>d2cnza_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
yqp

Timeline for d2cnza_:

• d2cnza_ first appeared in SCOP 1.73, called d2cnza1
  
• d2cnza_ was called d2cnza1 in SCOP 1.75
  
• d2cnza_ appears in SCOPe 2.02
  
• d2cnza_ appears in the current release, SCOPe 2.08