Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (6 families) |
Family b.2.3.2: Pilus subunits [49405] (8 proteins) |
Protein SafA pilus subunit [141080] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [141081] (10 PDB entries) Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170 |
Domain d2cnza1: 2cnz A:22-144 [130662] automatically matched to 2CO7 A:20-144 mutant |
PDB Entry: 2cnz (more details), 1.8 Å
SCOP Domain Sequences for d2cnza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnza1 b.2.3.2 (A:22-144) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]} dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg yqp
Timeline for d2cnza1: