Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein automated matches [190569] (7 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [187560] (4 PDB entries) |
Domain d2cnya_: 2cny A: [130661] automated match to d2co7a1 mutant |
PDB Entry: 2cny (more details), 1.9 Å
SCOPe Domain Sequences for d2cnya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnya_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg yqp
Timeline for d2cnya_: