SCOP 1.75: Domain d2cnya1: 2cny A:22-144

Lineage for d2cnya1 (2cny A:22-144)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (8 proteins)

6. Protein SafA pilus subunit [141080] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [141081] (10 PDB entries)
   Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170

8. Domain d2cnya1: 2cny A:22-144 [130661]
   automatically matched to 2CO7 A:20-144
   mutant

Details for d2cnya1

PDB Entry: 2cny, 1.9 Å

PDB Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (i15a mutant)

PDB Compounds: (A:) putative outer membrane protein

SCOP Domain Sequences for d2cnya1:

Sequence; same for both SEQRES and ATOM records:

>d2cnya1 b.2.3.2 (A:22-144) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]}
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
yqp

Timeline for d2cnya1:

• d2cnya1 first appeared in SCOP 1.73
  
• d2cnya1 is called d2cnya_ in SCOPe 2.01
  
• d2cnya1 appears in the current release, SCOPe 2.08, called d2cnya_