Lineage for d2cnya_ (2cny A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767711Species Salmonella typhimurium [TaxId:90371] [187560] (4 PDB entries)
  8. 2767714Domain d2cnya_: 2cny A: [130661]
    automated match to d2co7a1
    mutant

Details for d2cnya_

PDB Entry: 2cny (more details), 1.9 Å

PDB Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (i15a mutant)
PDB Compounds: (A:) putative outer membrane protein

SCOPe Domain Sequences for d2cnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnya_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
yqp

SCOPe Domain Coordinates for d2cnya_:

Click to download the PDB-style file with coordinates for d2cnya_.
(The format of our PDB-style files is described here.)

Timeline for d2cnya_: