![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
![]() | Family a.24.13.0: automated matches [229049] (1 protein) not a true family |
![]() | Protein automated matches [229050] (4 species) not a true protein |
![]() | Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries) |
![]() | Domain d2cnwd1: 2cnw D:21-90 [130655] Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf2 automated match to d1okkd1 protein/RNA complex; complexed with 5gp, alf, gdp, mg |
PDB Entry: 2cnw (more details), 2.39 Å
SCOPe Domain Sequences for d2cnwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnwd1 a.24.13.0 (D:21-90) automated matches {Thermus aquaticus [TaxId: 271]} aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde rratlrklgf
Timeline for d2cnwd1: