Lineage for d2cnwa2 (2cnw A:89-293)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847600Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1847730Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 1847741Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)
  8. 1847762Domain d2cnwa2: 2cnw A:89-293 [130650]
    Other proteins in same PDB: d2cnwa1, d2cnwb1, d2cnwc1, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2
    automated match to d1okka2
    protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwa2

PDB Entry: 2cnw (more details), 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy
PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2cnwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnwa2 c.37.1.10 (A:89-293) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilg

SCOPe Domain Coordinates for d2cnwa2:

Click to download the PDB-style file with coordinates for d2cnwa2.
(The format of our PDB-style files is described here.)

Timeline for d2cnwa2: