Class a: All alpha proteins [46456] (286 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
Protein Signal sequence recognition protein Ffh [47366] (3 species) |
Species Thermus aquaticus [TaxId:271] [47367] (17 PDB entries) |
Domain d2cnwa1: 2cnw A:4-88 [130649] Other proteins in same PDB: d2cnwa2, d2cnwb2, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2 automated match to d1okka1 protein/RNA complex; complexed with 5gp, alf, gdp, mg |
PDB Entry: 2cnw (more details), 2.39 Å
SCOPe Domain Sequences for d2cnwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnwa1 a.24.13.1 (A:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq vlesltpaevilatvyealkealgg
Timeline for d2cnwa1: