SCOPe 2.05: Domain d2cnwa1: 2cnw A:4-88

Lineage for d2cnwa1 (2cnw A:4-88)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (17 PDB entries)

8. Domain d2cnwa1: 2cnw A:4-88 [130649]
   Other proteins in same PDB: d2cnwa2, d2cnwb2, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2
   automated match to d1okka1
   protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwa1

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2cnwa1:

Sequence; same for both SEQRES and ATOM records:

>d2cnwa1 a.24.13.1 (A:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
vlesltpaevilatvyealkealgg

Timeline for d2cnwa1:

• d2cnwa1 first appeared in SCOP 1.73
  
• d2cnwa1 appears in SCOPe 2.04
  
• d2cnwa1 appears in SCOPe 2.06
  
• d2cnwa1 appears in the current release, SCOPe 2.08