Lineage for d2cnua1 (2cnu A:2-305)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734637Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 734638Superfamily d.143.1: SAICAR synthase-like [56104] (3 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 734639Family d.143.1.1: SAICAR synthase [56105] (1 protein)
  6. 734640Protein SAICAR synthase [56106] (2 species)
  7. 734641Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56107] (6 PDB entries)
  8. 734643Domain d2cnua1: 2cnu A:2-305 [130647]
    automatically matched to d1a48__
    complexed with ace, asp, so4

Details for d2cnua1

PDB Entry: 2cnu (more details), 1.05 Å

PDB Description: atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with aspartic acid
PDB Compounds: (A:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOP Domain Sequences for d2cnua1:

Sequence, based on SEQRES records: (download)

>d2cnua1 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
skws

Sequence, based on observed residues (ATOM records): (download)

>d2cnua1 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaehdenispaqaaelvg
edlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfw
ngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskw
s

SCOP Domain Coordinates for d2cnua1:

Click to download the PDB-style file with coordinates for d2cnua1.
(The format of our PDB-style files is described here.)

Timeline for d2cnua1: