Lineage for d2cnua_ (2cnu A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542070Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2542071Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2542072Family d.143.1.1: SAICAR synthase [56105] (1 protein)
    automatically mapped to Pfam PF01259
  6. 2542073Protein SAICAR synthase [56106] (2 species)
  7. 2542074Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56107] (6 PDB entries)
  8. 2542076Domain d2cnua_: 2cnu A: [130647]
    automated match to d1a48__
    complexed with asp, so4

Details for d2cnua_

PDB Entry: 2cnu (more details), 1.05 Å

PDB Description: atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with aspartic acid
PDB Compounds: (A:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOPe Domain Sequences for d2cnua_:

Sequence, based on SEQRES records: (download)

>d2cnua_ d.143.1.1 (A:) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
skwsh

Sequence, based on observed residues (ATOM records): (download)

>d2cnua_ d.143.1.1 (A:) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaehdenispaqaaelvg
edlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfw
ngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskw
sh

SCOPe Domain Coordinates for d2cnua_:

Click to download the PDB-style file with coordinates for d2cnua_.
(The format of our PDB-style files is described here.)

Timeline for d2cnua_: