SCOPe 2.08: Domain d2cnjd2: 2cnj D:1510-1651

Lineage for d2cnjd2 (2cnj D:1510-1651)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
   barrel, partly open; n*=8, S*=10; one psi loop

4. Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family)

5. Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)

6. Protein automated matches [254500] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255090] (5 PDB entries)

8. Domain d2cnjd2: 2cnj D:1510-1651 [130645]
   Other proteins in same PDB: d2cnjd3
   automated match to d1gqba_

Details for d2cnjd2

PDB Entry: 2cnj

PDB Description: nmr studies on the interaction of insulin-growth factor ii (igf-ii) with igf2r domain 11

PDB Compounds: (D:) cation-independent mannose-6-phosphate receptor

SCOPe Domain Sequences for d2cnjd2:

Sequence; same for both SEQRES and ATOM records:

>d2cnjd2 b.64.1.1 (D:1510-1651) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snehddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgq
trisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisl
dkqtctlffswhtplaceqatk

Timeline for d2cnjd2:

• d2cnjd2 first appeared in SCOP 1.73, called d2cnjd1
  
• d2cnjd2 appears in SCOPe 2.07