Lineage for d2cnjd2 (2cnj D:1510-1651)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807135Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2807136Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2807137Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2807195Protein automated matches [254500] (3 species)
    not a true protein
  7. 2807198Species Human (Homo sapiens) [TaxId:9606] [255090] (5 PDB entries)
  8. 2807203Domain d2cnjd2: 2cnj D:1510-1651 [130645]
    Other proteins in same PDB: d2cnjd3
    automated match to d1gqba_

Details for d2cnjd2

PDB Entry: 2cnj (more details)

PDB Description: nmr studies on the interaction of insulin-growth factor ii (igf-ii) with igf2r domain 11
PDB Compounds: (D:) cation-independent mannose-6-phosphate receptor

SCOPe Domain Sequences for d2cnjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnjd2 b.64.1.1 (D:1510-1651) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snehddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgq
trisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisl
dkqtctlffswhtplaceqatk

SCOPe Domain Coordinates for d2cnjd2:

Click to download the PDB-style file with coordinates for d2cnjd2.
(The format of our PDB-style files is described here.)

Timeline for d2cnjd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cnjd3