![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily) barrel, partly open; n*=8, S*=10; one psi loop |
![]() | Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) ![]() |
![]() | Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins) |
![]() | Protein automated matches [254500] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255090] (5 PDB entries) |
![]() | Domain d2cnjd2: 2cnj D:1510-1651 [130645] Other proteins in same PDB: d2cnjd3 automated match to d1gqba_ |
PDB Entry: 2cnj (more details)
SCOPe Domain Sequences for d2cnjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnjd2 b.64.1.1 (D:1510-1651) automated matches {Human (Homo sapiens) [TaxId: 9606]} snehddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgq trisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisl dkqtctlffswhtplaceqatk
Timeline for d2cnjd2: