| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
| Protein Tyrosine phosphatase [52806] (7 species) |
| Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (96 PDB entries) Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299 |
| Domain d2cnia1: 2cni A:3-299 [130644] automatically matched to d1q1ma_ complexed with izf, mg |
PDB Entry: 2cni (more details), 2 Å
SCOPe Domain Sequences for d2cnia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnia1 c.45.1.2 (A:3-299) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqe
dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
qywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdf
gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
svdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl
Timeline for d2cnia1: