Lineage for d2cnba1 (2cnb A:-1-381)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820705Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species)
  7. 820741Species Trypanosoma brucei [TaxId:5691] [89519] (2 PDB entries)
  8. 820746Domain d2cnba1: 2cnb A:-1-381 [130636]
    automatically matched to d1gy8a_
    complexed with nad, ufg

Details for d2cnba1

PDB Entry: 2cnb (more details), 2.7 Å

PDB Description: trypanosoma brucei udp-galactose-4-epimerase in ternary complex with nad and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose
PDB Compounds: (A:) udp-galactose-4-epimerase

SCOP Domain Sequences for d2cnba1:

Sequence, based on SEQRES records: (download)

>d2cnba1 c.2.1.2 (A:-1-381) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]}
shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
ydtleaimetswkfqrthpngya

Sequence, based on observed residues (ATOM records): (download)

>d2cnba1 c.2.1.2 (A:-1-381) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]}
shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
vvgilrllqamllhkcdkiifsssaaifgnptnaepidinakkspespygeskliaermi
rdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapddkrmpif
gtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrev
ievarkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrt
hpngya

SCOP Domain Coordinates for d2cnba1:

Click to download the PDB-style file with coordinates for d2cnba1.
(The format of our PDB-style files is described here.)

Timeline for d2cnba1: