SCOP 1.75: Domain d2cn4b1: 2cn4 B:2-174

Lineage for d2cn4b1 (2cn4 B:2-174)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
   beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432

4. Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (1 family)

5. Family d.35.1.1: Heme-binding protein A (HasA) [54622] (1 protein)

6. Protein Heme-binding protein A (HasA) [54623] (1 species)

7. Species Serratia marcescens [TaxId:615] [54624] (5 PDB entries)

8. Domain d2cn4b1: 2cn4 B:2-174 [130635]
   automatically matched to d1b2va_
   complexed with hem, po4

Details for d2cn4b1

PDB Entry: 2cn4, 2.3 Å

PDB Description: the crystal structure of the secreted dimeric form of the hemophore hasa reveals a domain swapping with an exchanged heme ligand

PDB Compounds: (B:) hemophore hasa

SCOP Domain Sequences for d2cn4b1:

Sequence; same for both SEQRES and ATOM records:

>d2cn4b1 d.35.1.1 (B:2-174) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

Timeline for d2cn4b1:

• d2cn4b1 first appeared in SCOP 1.73
  
• d2cn4b1 is called d2cn4b_ in SCOPe 2.01
  
• d2cn4b1 appears in the current release, SCOPe 2.08, called d2cn4b_