SCOP 1.75: Domain d2cmya1: 2cmy A:16-245

Lineage for d2cmya1 (2cmy A:16-245)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
   Uniprot P00760

8. Domain d2cmya1: 2cmy A:16-245 [130632]
   Other proteins in same PDB: d2cmyb1
   automatically matched to d1tgsz_
   complexed with ca, gol, so4

Details for d2cmya1

PDB Entry: 2cmy, 2.25 Å

PDB Description: crystal complex between bovine trypsin and veronica hederifolia trypsin inhibitor

PDB Compounds: (A:) cationic trypsin

SCOP Domain Sequences for d2cmya1:

Sequence; same for both SEQRES and ATOM records:

>d2cmya1 b.47.1.2 (A:16-245) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2cmya1:

• d2cmya1 first appeared in SCOP 1.73
  
• d2cmya1 is called d2cmya_ in SCOPe 2.01
  
• d2cmya1 appears in the current release, SCOPe 2.08, called d2cmya_