SCOP 1.73: Domain d2cmob1: 2cmo B:5-261

Lineage for d2cmob1 (2cmo B:5-261)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (53 PDB entries)

8. Domain d2cmob1: 2cmo B:5-261 [130631]
   automatically matched to d1mm6a_
   complexed with glu, m1l, so4

Details for d2cmob1

PDB Entry: 2cmo, 2.65 Å

PDB Description: the structure of a mixed glur2 ligand-binding core dimer in complex with (s)-glutamate and the antagonist (s)-ns1209

PDB Compounds: (B:) Glutamate receptor 2

SCOP Domain Sequences for d2cmob1:

Sequence; same for both SEQRES and ATOM records:

>d2cmob1 c.94.1.1 (B:5-261) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq
glldklknkwwydkgec

Timeline for d2cmob1:

• d2cmob1 is new in SCOP 1.73
  
• d2cmob1 appears in SCOP 1.75
  
• d2cmob1 appears in the current release, SCOPe 2.08, called d2cmob_