SCOPe 2.07: Domain d2cmoa_: 2cmo A:

Lineage for d2cmoa_ (2cmo A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d2cmoa_: 2cmo A: [130630]
   automated match to d1lb8a_
   protein/RNA complex; complexed with glu, m1l, so4

Details for d2cmoa_

PDB Entry: 2cmo, 2.65 Å

PDB Description: the structure of a mixed glur2 ligand-binding core dimer in complex with (s)-glutamate and the antagonist (s)-ns1209

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2cmoa_:

Sequence; same for both SEQRES and ATOM records:

>d2cmoa_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq
glldklknkwwydkgec

Timeline for d2cmoa_:

• d2cmoa_ first appeared in SCOP 1.73, called d2cmoa1
  
• d2cmoa_ appears in SCOPe 2.06
  
• d2cmoa_ appears in the current release, SCOPe 2.08