Lineage for d2cmoa_ (2cmo A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521242Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2521254Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. 2521525Domain d2cmoa_: 2cmo A: [130630]
    automated match to d1lb8a_
    protein/RNA complex; complexed with glu, m1l, so4

Details for d2cmoa_

PDB Entry: 2cmo (more details), 2.65 Å

PDB Description: the structure of a mixed glur2 ligand-binding core dimer in complex with (s)-glutamate and the antagonist (s)-ns1209
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2cmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmoa_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq
glldklknkwwydkgec

SCOPe Domain Coordinates for d2cmoa_:

Click to download the PDB-style file with coordinates for d2cmoa_.
(The format of our PDB-style files is described here.)

Timeline for d2cmoa_: