Lineage for d2cmoa1 (2cmo A:5-261)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846372Protein Glutamate receptor ligand binding core [53881] (4 species)
  7. 846373Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (57 PDB entries)
  8. 846499Domain d2cmoa1: 2cmo A:5-261 [130630]
    automatically matched to d1mm6a_
    complexed with glu, m1l, so4

Details for d2cmoa1

PDB Entry: 2cmo (more details), 2.65 Å

PDB Description: the structure of a mixed glur2 ligand-binding core dimer in complex with (s)-glutamate and the antagonist (s)-ns1209
PDB Compounds: (A:) Glutamate receptor 2

SCOP Domain Sequences for d2cmoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmoa1 c.94.1.1 (A:5-261) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq
glldklknkwwydkgec

SCOP Domain Coordinates for d2cmoa1:

Click to download the PDB-style file with coordinates for d2cmoa1.
(The format of our PDB-style files is described here.)

Timeline for d2cmoa1: