Lineage for d2cmeh_ (2cme H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089428Fold b.164: SARS ORF9b-like [141665] (1 superfamily)
    complex dimeric fold with three intersubunit beta-sheets packed around a single core
  4. 2089429Superfamily b.164.1: 'SARS ORF9b-like [141666] (1 family) (S)
  5. 2089430Family b.164.1.1: SARS ORF9b-like [141667] (1 protein)
    PfamB PB005852
  6. 2089431Protein Hypothetical protein 5 (ORF-9b) [141668] (1 species)
  7. 2089432Species SARS coronavirus [TaxId:227859] [141669] (1 PDB entry)
    Uniprot P59636 9-98
  8. 2089440Domain d2cmeh_: 2cme H: [130628]
    automated match to d2cmec1
    complexed with d10

Details for d2cmeh_

PDB Entry: 2cme (more details), 2.8 Å

PDB Description: the crystal structure of sars coronavirus orf-9b protein
PDB Compounds: (H:) hypothetical protein 5

SCOPe Domain Sequences for d2cmeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmeh_ b.164.1.1 (H:) Hypothetical protein 5 (ORF-9b) {SARS coronavirus [TaxId: 227859]}
ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
atteelpdefvvvtak

SCOPe Domain Coordinates for d2cmeh_:

Click to download the PDB-style file with coordinates for d2cmeh_.
(The format of our PDB-style files is described here.)

Timeline for d2cmeh_: