![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.164: SARS ORF9b-like [141665] (1 superfamily) complex dimeric fold with three intersubunit beta-sheets packed around a single core |
![]() | Superfamily b.164.1: 'SARS ORF9b-like [141666] (1 family) ![]() |
![]() | Family b.164.1.1: SARS ORF9b-like [141667] (1 protein) PfamB PB005852 |
![]() | Protein Hypothetical protein 5 (ORF-9b) [141668] (1 species) |
![]() | Species SARS coronavirus [TaxId:227859] [141669] (1 PDB entry) Uniprot P59636 9-98 |
![]() | Domain d2cmef1: 2cme F:10-98 [130626] automatically matched to 2CME E:9-98 complexed with d10 |
PDB Entry: 2cme (more details), 2.8 Å
SCOP Domain Sequences for d2cmef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cmef1 b.164.1.1 (F:10-98) Hypothetical protein 5 (ORF-9b) {SARS coronavirus [TaxId: 227859]} ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl atteelpdefvvvtak
Timeline for d2cmef1: