Lineage for d2cmef1 (2cme F:10-98)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 814027Fold b.164: SARS ORF9b-like [141665] (1 superfamily)
    complex dimeric fold with three intersubunit beta-sheets packed around a single core
  4. 814028Superfamily b.164.1: 'SARS ORF9b-like [141666] (1 family) (S)
  5. 814029Family b.164.1.1: SARS ORF9b-like [141667] (1 protein)
    PfamB PB005852
  6. 814030Protein Hypothetical protein 5 (ORF-9b) [141668] (1 species)
  7. 814031Species SARS coronavirus [TaxId:227859] [141669] (1 PDB entry)
    Uniprot P59636 9-98
  8. 814037Domain d2cmef1: 2cme F:10-98 [130626]
    automatically matched to 2CME E:9-98
    complexed with d10

Details for d2cmef1

PDB Entry: 2cme (more details), 2.8 Å

PDB Description: the crystal structure of sars coronavirus orf-9b protein
PDB Compounds: (F:) hypothetical protein 5

SCOP Domain Sequences for d2cmef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmef1 b.164.1.1 (F:10-98) Hypothetical protein 5 (ORF-9b) {SARS coronavirus [TaxId: 227859]}
ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
atteelpdefvvvtak

SCOP Domain Coordinates for d2cmef1:

Click to download the PDB-style file with coordinates for d2cmef1.
(The format of our PDB-style files is described here.)

Timeline for d2cmef1: