Lineage for d2cmba2 (2cmb A:2-281)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483190Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2483534Protein automated matches [190252] (5 species)
    not a true protein
  7. 2483537Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)
  8. 2483544Domain d2cmba2: 2cmb A:2-281 [130619]
    Other proteins in same PDB: d2cmba3
    automated match to d1bzja_
    complexed with bog, f17

Details for d2cmba2

PDB Entry: 2cmb (more details), 1.7 Å

PDB Description: structural basis for inhibition of protein tyrosine phosphatase 1b by isothiazolidinone heterocyclic phosphonate mimetics
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d2cmba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmba2 c.45.1.2 (A:2-281) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfi

SCOPe Domain Coordinates for d2cmba2:

Click to download the PDB-style file with coordinates for d2cmba2.
(The format of our PDB-style files is described here.)

Timeline for d2cmba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cmba3