Lineage for d2cm6b1 (2cm6 B:1541-1677)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 661406Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 661407Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 661469Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 661480Protein C2b-domain of rabphilin [49582] (1 species)
  7. 661481Species Rat (Rattus norvegicus) [TaxId:10116] [49583] (3 PDB entries)
  8. 661484Domain d2cm6b1: 2cm6 B:1541-1677 [130615]
    automatically matched to d3rpba_
    complexed with ca, po4

Details for d2cm6b1

PDB Entry: 2cm6 (more details), 1.85 Å

PDB Description: crystal structure of the c2b domain of rabphilin3a
PDB Compounds: (B:) rabphilin-3a

SCOP Domain Sequences for d2cm6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cm6b1 b.7.1.2 (B:1541-1677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]}
rgkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhktqikk
ktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlkhwye
clknkdkkierwhqlqn

SCOP Domain Coordinates for d2cm6b1:

Click to download the PDB-style file with coordinates for d2cm6b1.
(The format of our PDB-style files is described here.)

Timeline for d2cm6b1: