SCOPe 2.03: Domain d2cm6a_: 2cm6 A:

Lineage for d2cm6a_ (2cm6 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein automated matches [190234] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (4 PDB entries)

8. Domain d2cm6a_: 2cm6 A: [130614]
   automated match to d3rpba_
   complexed with ca, po4

Details for d2cm6a_

PDB Entry: 2cm6, 1.85 Å

PDB Description: crystal structure of the c2b domain of rabphilin3a

PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d2cm6a_:

Sequence, based on SEQRES records:

>d2cm6a_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
malyeeeqverigdieergkilvslmystqqgglivgiircvhlaamdangysdpfvklw
lkpdmgkkakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksndyigg
cqlgisakgerlkhwyeclknkdkkierwhqlqne

Sequence, based on observed residues (ATOM records):

>d2cm6a_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
malyeeeqverieergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkp
kkakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgis
akgerlkhwyeclknkdkkierwhqlqne

Timeline for d2cm6a_:

• d2cm6a_ first appeared in SCOP 1.73, called d2cm6a1
  
• d2cm6a_ was called d2cm6a1 in SCOPe 2.02
  
• d2cm6a_ appears in SCOPe 2.04
  
• d2cm6a_ appears in the current release, SCOPe 2.08