![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein automated matches [190234] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries) |
![]() | Domain d2cm6a_: 2cm6 A: [130614] automated match to d3rpba_ complexed with ca, po4 |
PDB Entry: 2cm6 (more details), 1.85 Å
SCOPe Domain Sequences for d2cm6a_:
Sequence, based on SEQRES records: (download)
>d2cm6a_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} malyeeeqverigdieergkilvslmystqqgglivgiircvhlaamdangysdpfvklw lkpdmgkkakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksndyigg cqlgisakgerlkhwyeclknkdkkierwhqlqne
>d2cm6a_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} malyeeeqverieergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkp kkakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgis akgerlkhwyeclknkdkkierwhqlqne
Timeline for d2cm6a_: