SCOPe 2.07: Domain d2cm3a_: 2cm3 A:

Lineage for d2cm3a_ (2cm3 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)

8. Domain d2cm3a_: 2cm3 A: [130611]
   automated match to d1bzja_
   complexed with ca

Details for d2cm3a_

PDB Entry: 2cm3, 2.1 Å

PDB Description: structure of protein tyrosine phosphatase 1b (c2)

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d2cm3a_:

Sequence; same for both SEQRES and ATOM records:

>d2cm3a_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
feqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqedndy
inaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaqywp
qkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgvpe
spasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssvdi
kkvllemrkfrmgliqtadqlrfsylaviegakfi

Timeline for d2cm3a_:

• d2cm3a_ first appeared in SCOP 1.73, called d2cm3a1
  
• d2cm3a_ appears in SCOPe 2.06
  
• d2cm3a_ appears in the current release, SCOPe 2.08