Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein automated matches [190252] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187034] (22 PDB entries) |
Domain d2cm3a_: 2cm3 A: [130611] automated match to d1bzja_ complexed with ca |
PDB Entry: 2cm3 (more details), 2.1 Å
SCOPe Domain Sequences for d2cm3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cm3a_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} feqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqedndy inaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaqywp qkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgvpe spasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssvdi kkvllemrkfrmgliqtadqlrfsylaviegakfi
Timeline for d2cm3a_: