SCOP 1.73: Domain d2cm3a1: 2cm3 A:7-281

Lineage for d2cm3a1 (2cm3 A:7-281)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (91 PDB entries)

8. Domain d2cm3a1: 2cm3 A:7-281 [130611]
   automatically matched to d1ptta_
   complexed with ca

Details for d2cm3a1

PDB Entry: 2cm3, 2.1 Å

PDB Description: structure of protein tyrosine phosphatase 1b (c2)

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOP Domain Sequences for d2cm3a1:

Sequence; same for both SEQRES and ATOM records:

>d2cm3a1 c.45.1.2 (A:7-281) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
feqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqedndy
inaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaqywp
qkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgvpe
spasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssvdi
kkvllemrkfrmgliqtadqlrfsylaviegakfi

Timeline for d2cm3a1:

• d2cm3a1 is new in SCOP 1.73
  
• d2cm3a1 appears in SCOP 1.75
  
• d2cm3a1 appears in the current release, SCOPe 2.08, called d2cm3a_