Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.314: PUG domain-like [143502] (1 superfamily) alpha(2)-beta-alpha(2)-beta(2)-alpha; cluster of helices with a small antiparallel beta-sheet on one side; order 132; topological similarity to the fold of an extended R3H domain (PDB 1whr) |
Superfamily d.314.1: PUG domain-like [143503] (1 family) |
Family d.314.1.1: PUG domain [143504] (1 protein) SMART 00580; domain in protein kinases, N-glycanases and other nuclear proteins |
Protein N-glycanase 1, N-terminal domain [143505] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [143507] (2 PDB entries) |
Domain d2cm0a1: 2cm0 A:11-109 [130609] complexed with bme, peg; mutant |
PDB Entry: 2cm0 (more details), 1.9 Å
SCOP Domain Sequences for d2cm0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cm0a1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gsaspavaelcqntpetfleaskllltyadailrnpndeaarsirigntafstrllpvrg aveclfemgfeegethlifpkkasveqlqkirdliaier
Timeline for d2cm0a1: