Lineage for d2clzh2 (2clz H:3-180)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897650Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries)
  8. 1897655Domain d2clzh2: 2clz H:3-180 [130607]
    Other proteins in same PDB: d2clza1, d2clzb_, d2clzh1, d2clzp_
    automatically matched to d1ddha2
    mutant

Details for d2clzh2

PDB Entry: 2clz (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide
PDB Compounds: (H:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d2clzh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clzh2 d.19.1.1 (H:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

SCOPe Domain Coordinates for d2clzh2:

Click to download the PDB-style file with coordinates for d2clzh2.
(The format of our PDB-style files is described here.)

Timeline for d2clzh2: