Lineage for d2clzb1 (2clz B:1-99)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784227Domain d2clzb1: 2clz B:1-99 [130605]
    Other proteins in same PDB: d2clza1, d2clza2, d2clzh1, d2clzh2
    automatically matched to d1bz9b_
    mutant

Details for d2clzb1

PDB Entry: 2clz (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide
PDB Compounds: (B:) beta-2 microglobulin

SCOP Domain Sequences for d2clzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clzb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d2clzb1:

Click to download the PDB-style file with coordinates for d2clzb1.
(The format of our PDB-style files is described here.)

Timeline for d2clzb1: