![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
![]() | Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries) |
![]() | Domain d2clza2: 2clz A:3-180 [130604] Other proteins in same PDB: d2clza1, d2clzb_, d2clzh1, d2clzp_ automatically matched to d1ddha2 mutant |
PDB Entry: 2clz (more details), 1.9 Å
SCOPe Domain Sequences for d2clza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clza2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
Timeline for d2clza2:
![]() Domains from other chains: (mouse over for more information) d2clzb_, d2clzh1, d2clzh2, d2clzp_ |