SCOPe 2.07: Domain d2clwb_: 2clw B:

Lineage for d2clwb_ (2clw B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)

8. Domain d2clwb_: 2clw B: [130597]
   automated match to d1ur6a_
   complexed with gol, so4

Details for d2clwb_

PDB Entry: 2clw, 1.94 Å

PDB Description: Crystal structure of human ubiquitin-conjugating enzyme UbcH5B

PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d2clwb_:

Sequence; same for both SEQRES and ATOM records:

>d2clwb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
plvpeiariyktdrekynriarewtqkyam

Timeline for d2clwb_:

• d2clwb_ first appeared in SCOP 1.73, called d2clwb1
  
• d2clwb_ appears in SCOPe 2.06
  
• d2clwb_ appears in the current release, SCOPe 2.08