Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.1: UBC-related [54496] (6 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species) |
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (8 PDB entries) Uniprot P62837 E2-17 kDa 2 |
Domain d2clwb1: 2clw B:1-147 [130597] automatically matched to d1ur6a_ complexed with gol, so4 |
PDB Entry: 2clw (more details), 1.95 Å
SCOP Domain Sequences for d2clwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clwb1 d.20.1.1 (B:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv peiariyktdrekynriarewtqkyam
Timeline for d2clwb1: