Lineage for d2clwa_ (2clw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939272Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)
  8. 2939297Domain d2clwa_: 2clw A: [130596]
    automated match to d1ur6a_
    complexed with gol, so4

Details for d2clwa_

PDB Entry: 2clw (more details), 1.94 Å

PDB Description: Crystal structure of human ubiquitin-conjugating enzyme UbcH5B
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d2clwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clwa_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
plvpeiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d2clwa_:

Click to download the PDB-style file with coordinates for d2clwa_.
(The format of our PDB-style files is described here.)

Timeline for d2clwa_: