Lineage for d2clvh2 (2clv H:3-180)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183074Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2183077Domain d2clvh2: 2clv H:3-180 [130594]
    Other proteins in same PDB: d2clva1, d2clvb_, d2clvh1, d2clvp_
    automatically matched to d1ddha2
    mutant

Details for d2clvh2

PDB Entry: 2clv (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm8 peptide
PDB Compounds: (H:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d2clvh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clvh2 d.19.1.1 (H:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

SCOPe Domain Coordinates for d2clvh2:

Click to download the PDB-style file with coordinates for d2clvh2.
(The format of our PDB-style files is described here.)

Timeline for d2clvh2: