| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
| Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries) |
| Domain d2clvh2: 2clv H:3-180 [130594] Other proteins in same PDB: d2clva1, d2clvb_, d2clvh1, d2clvp_ automatically matched to d1ddha2 mutant |
PDB Entry: 2clv (more details), 1.9 Å
SCOPe Domain Sequences for d2clvh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clvh2 d.19.1.1 (H:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
Timeline for d2clvh2:
View in 3DDomains from other chains: (mouse over for more information) d2clva1, d2clva2, d2clvb_, d2clvp_ |