Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries) Uniprot P01901 22-299 |
Domain d2clvh1: 2clv H:182-274 [130593] Other proteins in same PDB: d2clva2, d2clvb_, d2clvh2, d2clvp_ automatically matched to d1ddha1 mutant |
PDB Entry: 2clv (more details), 1.9 Å
SCOPe Domain Sequences for d2clvh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clvh1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d2clvh1:
View in 3D Domains from other chains: (mouse over for more information) d2clva1, d2clva2, d2clvb_, d2clvp_ |