Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries) |
Domain d2clva2: 2clv A:3-180 [130591] Other proteins in same PDB: d2clva1, d2clvb_, d2clvh1, d2clvp_ automatically matched to d1ddha2 mutant |
PDB Entry: 2clv (more details), 1.9 Å
SCOPe Domain Sequences for d2clva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clva2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
Timeline for d2clva2:
View in 3D Domains from other chains: (mouse over for more information) d2clvb_, d2clvh1, d2clvh2, d2clvp_ |