SCOP 1.73: Domain d2cltb2: 2clt B:81-252

Lineage for d2cltb2 (2clt B:81-252)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [55531] (2 PDB entries)

8. Domain d2cltb2: 2clt B:81-252 [130589]
   Other proteins in same PDB: d2clta1, d2cltb1
   automatically matched to d1fbl_2
   complexed with ca, zn; mutant

Details for d2cltb2

PDB Entry: 2clt, 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.

PDB Compounds: (B:) interstitial collagenase

SCOP Domain Sequences for d2cltb2:

Sequence; same for both SEQRES and ATOM records:

>d2cltb2 d.92.1.11 (B:81-252) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa) [TaxId: 9823]}
fvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaaha
lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpig

Timeline for d2cltb2:

• d2cltb2 is new in SCOP 1.73
  
• d2cltb2 appears in SCOP 1.75
  
• d2cltb2 appears in the current release, SCOPe 2.08