SCOP 1.75: Domain d2cltb1: 2clt B:253-447

Lineage for d2cltb1 (2clt B:253-447)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (1 family)

5. Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins)

6. Protein Collagenase (MMP1), C-terminal domain [50929] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50930] (2 PDB entries)

8. Domain d2cltb1: 2clt B:253-447 [130588]
   Other proteins in same PDB: d2clta2, d2cltb2
   automatically matched to d1fbl_1
   complexed with ca, zn; mutant

Details for d2cltb1

PDB Entry: 2clt, 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.

PDB Compounds: (B:) interstitial collagenase

SCOP Domain Sequences for d2cltb1:

Sequence; same for both SEQRES and ATOM records:

>d2cltb1 b.66.1.1 (B:253-447) Collagenase (MMP1), C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
pqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaa
yefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyf
fvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpkt
kriltlqkanswfnc

Timeline for d2cltb1:

• d2cltb1 first appeared in SCOP 1.73
  
• d2cltb1 appears in SCOPe 2.01
  
• d2cltb1 appears in the current release, SCOPe 2.08