Lineage for d2clta2 (2clt A:81-252)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1918283Protein automated matches [190182] (1 species)
    not a true protein
  7. 1918284Species Human (Homo sapiens) [TaxId:9606] [186920] (32 PDB entries)
  8. 1918325Domain d2clta2: 2clt A:81-252 [130587]
    Other proteins in same PDB: d2clta1, d2cltb1
    automated match to d1fbla2
    complexed with ca, zn

Details for d2clta2

PDB Entry: 2clt (more details), 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.
PDB Compounds: (A:) interstitial collagenase

SCOPe Domain Sequences for d2clta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clta2 d.92.1.11 (A:81-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaaha
lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpig

SCOPe Domain Coordinates for d2clta2:

Click to download the PDB-style file with coordinates for d2clta2.
(The format of our PDB-style files is described here.)

Timeline for d2clta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2clta1