Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein automated matches [190182] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186920] (32 PDB entries) |
Domain d2clta2: 2clt A:81-252 [130587] Other proteins in same PDB: d2clta1, d2cltb1 automated match to d1fbla2 complexed with ca, zn |
PDB Entry: 2clt (more details), 2.67 Å
SCOPe Domain Sequences for d2clta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clta2 d.92.1.11 (A:81-252) automated matches {Human (Homo sapiens) [TaxId: 9606]} fvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaaha lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpig
Timeline for d2clta2: