Lineage for d2clta2 (2clt A:81-252)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729371Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 729390Species Pig (Sus scrofa) [TaxId:9823] [55531] (2 PDB entries)
  8. 729391Domain d2clta2: 2clt A:81-252 [130587]
    Other proteins in same PDB: d2clta1, d2cltb1
    automatically matched to d1fbl_2
    complexed with ca, zn; mutant

Details for d2clta2

PDB Entry: 2clt (more details), 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.
PDB Compounds: (A:) interstitial collagenase

SCOP Domain Sequences for d2clta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clta2 d.92.1.11 (A:81-252) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa) [TaxId: 9823]}
fvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaaha
lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpig

SCOP Domain Coordinates for d2clta2:

Click to download the PDB-style file with coordinates for d2clta2.
(The format of our PDB-style files is described here.)

Timeline for d2clta2:

Domains from same chain:
(mouse over for more information)
d2clta1
Domains from other chains:
(mouse over for more information)
d2cltb1, d2cltb2