SCOPe 2.07: Domain d2clta1: 2clt A:253-447

Lineage for d2clta1 (2clt A:253-447)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein automated matches [226897] (1 species)
   not a true protein
7. Species Human (Homo sapiens) [TaxId:9606] [225112] (1 PDB entry)

8. Domain d2clta1: 2clt A:253-447 [130586]
   Other proteins in same PDB: d2clta2, d2cltb2
   automated match to d1fbla1
   complexed with ca, zn

Details for d2clta1

PDB Entry: 2clt, 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.

PDB Compounds: (A:) interstitial collagenase

SCOPe Domain Sequences for d2clta1:

Sequence; same for both SEQRES and ATOM records:

>d2clta1 b.66.1.1 (A:253-447) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaa
yefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyf
fvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpkt
kriltlqkanswfnc

Timeline for d2clta1:

• d2clta1 first appeared in SCOP 1.73
  
• d2clta1 appears in SCOPe 2.06
  
• d2clta1 appears in the current release, SCOPe 2.08