Lineage for d2clta1 (2clt A:253-447)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674775Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 674776Superfamily b.66.1: Hemopexin-like domain [50923] (1 family) (S)
  5. 674777Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins)
  6. 674778Protein Collagenase (MMP1), C-terminal domain [50929] (2 species)
  7. 674782Species Pig (Sus scrofa) [TaxId:9823] [50930] (2 PDB entries)
  8. 674783Domain d2clta1: 2clt A:253-447 [130586]
    Other proteins in same PDB: d2clta2, d2cltb2
    automatically matched to d1fbl_1
    complexed with ca, zn; mutant

Details for d2clta1

PDB Entry: 2clt (more details), 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.
PDB Compounds: (A:) interstitial collagenase

SCOP Domain Sequences for d2clta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clta1 b.66.1.1 (A:253-447) Collagenase (MMP1), C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
pqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaa
yefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyf
fvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpkt
kriltlqkanswfnc

SCOP Domain Coordinates for d2clta1:

Click to download the PDB-style file with coordinates for d2clta1.
(The format of our PDB-style files is described here.)

Timeline for d2clta1:

Domains from same chain:
(mouse over for more information)
d2clta2
Domains from other chains:
(mouse over for more information)
d2cltb1, d2cltb2